- Recombinant Methanocorpusculum labreanum Putative cobalt transport protein CbiM 1 (cbiM1)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1008655
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 24,296 Da
- E Coli or Yeast
- Putative cobalt transport protein CbiM 1 (cbiM1)
- 1-231
Sequence
MHFMDGFLPIGWCVFWAVLAAPFLIYGMWKITKMINNDRHVLPLMAVCGAFIFVVSLVDIPSPTGSCSHPTGTGLSASFFGPAVTSVLGLIILVFQALLLGHGGFTTLGATAFSMAVMGPLAAWLVFKGLRKTGRVPLGPAVFCAAVVANCVTYLITSLQIALAYPVEGSVLTAFLAAAAVFAVVQIPISIIEGIISGLVATYIARIKPEILQKLGVISGEEVKKVLSEQA